Proteintech, 20128-1-AP, KCTD15 Polyclonal antibody

Size: 20ul / 150ul The KCTD15 (20128-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD15 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 20128-1-AP targets KCTD15 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, C6 cells, HEK-293 cells, mouse lung tissue Positive IP detected in: C6 cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KCTD15 is a member of the KCTD family of proteins, which are involved in various biological processes. KCTD15 plays a role in embryonic development by regulating the neural crest domain. It inhibits neural crest induction by repressing the Wnt/β-catenin signaling pathway. KCTD15 is involved in the NF-κB signaling pathway, which is crucial for immune responses and inflammation. Its deregulation can influence the activation of the IKK-β enzyme complex, triggering the NF-κB pathway. KCTD15's expression levels in peripheral blood cells and leukemia cells suggest its potential as a biomarker for diagnosing and monitoring acute leukemias. Its distinct expression profile in different types of white blood cells highlights its importance in both physiological and pathological processes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13962 Product name: Recombinant human KCTD15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-234 aa of BC001185 Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL Predict reactive species Full Name: potassium channel tetramerisation domain containing 15 Calculated Molecular Weight: 283 aa, 32 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC001185 Gene Symbol: KCTD15 Gene ID (NCBI): 79047 RRID: AB_10646430 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96SI1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.