Iright
BRAND / VENDOR: Proteintech

Proteintech, 20131-1-AP, SLC43A3 Polyclonal antibody

CATALOG NUMBER: 20131-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC43A3 (20131-1-AP) by Proteintech is a Polyclonal antibody targeting SLC43A3 in WB, IHC, ELISA applications with reactivity to human samples 20131-1-AP targets SLC43A3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, MCF-7 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Sodium-independent purine-selective nucleobase transporter(SLC43A3), also called as equilibrative nucleobase transporter 1(ENBT1), is a nucleobase transporter involved in purine salvage pathways in mammals, which mediates the equilibrative transport of extracellular purine nucleobases such as adenine, guanine and hypoxanthine.(PubMed:26455426, PubMed:32339528) It has been found that it may regulate the transport of fatty acids (FA) in fat cells, as a positive regulator of FA efflux and as a negative regulator of FA uptake.(PMID: 32217606) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13999 Product name: Recombinant human SLC43A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 211-278 aa of BC003163 Sequence: GHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRR Predict reactive species Full Name: solute carrier family 43, member 3 Calculated Molecular Weight: 491 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC003163 Gene Symbol: SLC43A3 Gene ID (NCBI): 29015 RRID: AB_3085599 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBI5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924