Iright
BRAND / VENDOR: Proteintech

Proteintech, 20146-1-AP, GPR81 Polyclonal antibody

CATALOG NUMBER: 20146-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR81 (20146-1-AP) by Proteintech is a Polyclonal antibody targeting GPR81 in WB, IHC, ELISA applications with reactivity to human, mouse samples 20146-1-AP targets GPR81 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue Positive IHC detected in: mouse pancreas tissue, human colon tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information GPR81 (G protein-coupled receptor 81) is one of a large family of GPRs with low affinity for hydroxy-carboxylic acid structure ligands (PMID: 24657625). Lactate functions as a signaling molecule by serving as an agonist for the GPR81, involving both autocrine and paracrine mechanisms (PMID: 31836453). Moreover, A higher molecular mass band (∼60 kDa) is present in the brain and adipose tissue. This band is also strong in the transfected HeLa cells but weak in native HeLa cells and is therefore probably a form of GPR81, possibly a glycosylated form of the receptor (PMID: 23696276). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13682 Product name: Recombinant human GPR81 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-346 aa of BC066881 Sequence: SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH Predict reactive species Full Name: G protein-coupled receptor 81 Calculated Molecular Weight: 346 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC066881 Gene Symbol: GPR81 Gene ID (NCBI): 27198 RRID: AB_2878647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924