Proteintech, 20148-1-AP, B4GALT6 Polyclonal antibody

Size: 20ul / 150ul The B4GALT6 (20148-1-AP) by Proteintech is a Polyclonal antibody targeting B4GALT6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20148-1-AP targets B4GALT6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse kidney tissue, HEK-293 cells, mouse brain tissue Positive IHC detected in: human colon tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Beta-1,4-galactosyltransferase 6 (B4GALT6) is a member of the beta 4-galactosyltransferase family that catalyzes the biosynthesis of glycosphingolipids in UDP-dependent manner (PMID: 23744354). B4GALT6 in astrocytes boosts CNS inflammation and promote neurodegeneration during chronic CNS inflammation (PMID: 25216636). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13686 Product name: Recombinant human B4GALT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-382 aa of BC074884 Sequence: MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY Predict reactive species Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 Calculated Molecular Weight: 382 aa, 45 kDa Observed Molecular Weight: 45-60 kDa GenBank Accession Number: BC074884 Gene Symbol: B4GALT6 Gene ID (NCBI): 9331 RRID: AB_10665357 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.