Iright
BRAND / VENDOR: Proteintech

Proteintech, 20149-1-AP, DDX51 Polyclonal antibody

CATALOG NUMBER: 20149-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDX51 (20149-1-AP) by Proteintech is a Polyclonal antibody targeting DDX51 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 20149-1-AP targets DDX51 in WB, IP, ELISA, IF applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, Raji cells Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The DEAD-box family (DDX) consists of a group of RNA helicases with the activity to hydrolyze ATP and to unwind RNA. The major physiological role of this family was to regulate RNA metabolism including ribosome assembly, RNA splicing, and pre-rRNA processing. DDX51 was a new gene in DDX family composed of 666 amino acids. DDX51 gene was a member of RNA helicases family in charge of regulating RNA metabolism(PMID: 31966432). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13691 Product name: Recombinant human DDX51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 317-666 aa of BC040185 Sequence: GQKSLAKEQESLVQKTADGYRCLADIVVATPGRLVDHIDQTPGFSLQQLRFLIIDEADRMIDSMHQSWLPRVVAAAFQSEDPADPCALLKRRQAQAVTAASTCCPQMPLQKLLFSATLTQNPEKLQQLGLHQPRLFSTGLAHRGLEDTDGDGDSGKYAFPVGLTHHYVPCSLSSKPLVVLHLVLEMGFSRVLCFTNSRENSHRLFLLVQAFGGVDVAEFSSRYGPGQRRMILKQFEQGKIQLLISTDATARGIDVQGVELVVNYDAPQYLRTYVHRVGRTARAGKTGQAFTLLLKVQERRFLRMLTEAGAPELQRHELSSKLLQPLVPRYEEALSKLEESVKEERKQRAA Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 51 Calculated Molecular Weight: 666 aa, 72 kDa Observed Molecular Weight: 72-80 kDa GenBank Accession Number: BC040185 Gene Symbol: DDX51 Gene ID (NCBI): 317781 RRID: AB_10665947 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N8A6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924