Proteintech, 20159-1-AP, GLB1L3 Polyclonal antibody

Size: 20ul / 150ul The GLB1L3 (20159-1-AP) by Proteintech is a Polyclonal antibody targeting GLB1L3 in WB, ELISA applications with reactivity to mouse, rat samples 20159-1-AP targets GLB1L3 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Glb1l3 is a member of the glycosyl hydrolase 35 family of proteins. These proteins display hydrolase activity catalyzing the cleavage of lactose, as well as galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans (PMID: 21633714). Glb1l3 has 3 isoforms produced by alternative splicing, which is 75kDa, 36kDa and 35kDa. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14083 Product name: Recombinant human GLB1L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC011001 Sequence: MKSPPLLSPCLSWKRMAGIFFLPFISSGFAPRFKQEENFMLGRAHPSQPRFNWSHLTPLELKNRSVGLGTESTGRGKPHFTLEGHKFLIF Predict reactive species Full Name: galactosidase, beta 1-like 3 Calculated Molecular Weight: 653 aa, 75 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC011001 Gene Symbol: GLB1L3 Gene ID (NCBI): 112937 RRID: AB_3669325 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCI6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.