Proteintech, 20160-1-AP, C9orf89 Polyclonal antibody

Size: 20ul / 150ul The C9orf89 (20160-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf89 in WB, ELISA applications with reactivity to human, mouse, rat samples 20160-1-AP targets C9orf89 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, C2C12 cells, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information C9orf89 (also known as CARD19 or BinCARD) is a mitochondria-localized protein that inhibits BCL10-induced NF-κB activation mainly through its caspase recruitment structural domain (CARD). It plays a role in T cell receptor (TCR) signaling, but deletion of endogenous CARD19 has a lesser effect on Bcl10-dependent NF-κB activation. In addition, C9orf89 is expressed in multiple cell types and is involved in the regulation of inflammatory and immune responses. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14084 Product name: Recombinant human C9orf89 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC004500 Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL Predict reactive species Full Name: chromosome 9 open reading frame 89 Calculated Molecular Weight: 228 aa, 26 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC004500 Gene Symbol: C9orf89 Gene ID (NCBI): 84270 RRID: AB_3669326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LW7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.