Proteintech, 20179-1-AP, C20orf4 Polyclonal antibody

Size: 20ul / 150ul The C20orf4 (20179-1-AP) by Proteintech is a Polyclonal antibody targeting C20orf4 in WB, ELISA applications with reactivity to human, mouse, rat samples 20179-1-AP targets C20orf4 in WB, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14039 Product name: Recombinant human C20orf4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-384 aa of BC001751 Sequence: MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFISEATVEKLQPENRQICAFSDVLPVLSMKHTKDRVGQNLPRCGIECKSYQEGLARLPEMKPRAGTEIRFSELPTQMFPEGATPAEITKHSMDLSYALETVLNKQFPSSPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNLLCRSEAAMMKHHTLYINLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVDATLRKKAEKFQAHLTKKFRWDFAAEPEDCAPVVVELPEGIEMG Predict reactive species Full Name: chromosome 20 open reading frame 4 Calculated Molecular Weight: 384 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC001751 Gene Symbol: C20orf4 Gene ID (NCBI): 25980 RRID: AB_2878653 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y312 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.