Proteintech, 20184-1-AP, MAPK12 Polyclonal antibody

Size: 20ul / 150ul The MAPK12 (20184-1-AP) by Proteintech is a Polyclonal antibody targeting MAPK12 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 20184-1-AP targets MAPK12 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, mouse skeletal muscle tissue, rat heart tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: mouse heart tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14073 Product name: Recombinant human MAPK12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 216-349 aa of BC015741 Sequence: MAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVL Predict reactive species Full Name: mitogen-activated protein kinase 12 Calculated Molecular Weight: 367 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC015741 Gene Symbol: MAPK12 Gene ID (NCBI): 6300 RRID: AB_10665949 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53778 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.