Iright
BRAND / VENDOR: Proteintech

Proteintech, 20188-1-AP, RFXAP Polyclonal antibody

CATALOG NUMBER: 20188-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RFXAP (20188-1-AP) by Proteintech is a Polyclonal antibody targeting RFXAP in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 20188-1-AP targets RFXAP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, MOLT-4 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RFXAP is a subunit of the RFX complex that binds to the X-box of MHC II promoters. It's involved in Bare lymphocyte syndrome 2 (BLS2). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14100 Product name: Recombinant human RFXAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 80-272 aa of BC026088 Sequence: DGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM Predict reactive species Full Name: regulatory factor X-associated protein Calculated Molecular Weight: 272 aa, 28 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC026088 Gene Symbol: RFXAP Gene ID (NCBI): 5994 RRID: AB_10697835 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00287 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924