Proteintech, 20190-1-AP, GPR105 Polyclonal antibody

Size: 20ul / 150ul The GPR105 (20190-1-AP) by Proteintech is a Polyclonal antibody targeting GPR105 in IHC, ELISA applications with reactivity to human, mouse, rat samples 20190-1-AP targets GPR105 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human stomach tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GPR105 (also known as P2RY14) is widely expressed throughout many brain regions and peripheral tissues of humans and rodents, and couples to a pertussis toxin-sensitive G protein (PMID: 14559350). Notably, GPR105 is also prominently expressed in immune cells, including macrophages, lymphocytes, and neutrophils (PMID: 22778393). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14105 Product name: Recombinant human GPR105 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-338 aa of BC034989 Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL Predict reactive species Full Name: purinergic receptor P2Y, G-protein coupled, 14 Calculated Molecular Weight: 338 aa, 39 kDa GenBank Accession Number: BC034989 Gene Symbol: P2RY14 Gene ID (NCBI): 9934 RRID: AB_10693612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15391 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.