Product Description
Size: 20ul / 150ul
The ISCA1 (20324-1-AP) by Proteintech is a Polyclonal antibody targeting ISCA1 in WB, ELISA applications with reactivity to human, mouse samples
20324-1-AP targets ISCA1 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HepG2 cells, mouse cerebellum tissue, mouse heart tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
ISCA1, also named as HBLD2 and hIscA, belongs to the hesB/iscA family. It is involved in the assembly of mitochondrial iron-sulfur proteins. ISCA1 probably involved in the binding of an intermediate of Fe/S cluster assembly. ISCA1 plays an important role in both mitochondrial and cytosolic iron-sulfur cluster biogenesis, and a notable component of the latter is the interaction between ISCA1 and IOP1.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14188 Product name: Recombinant human ISCA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC002675 Sequence: MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI Predict reactive species
Full Name: iron-sulfur cluster assembly 1 homolog (S. cerevisiae)
Calculated Molecular Weight: 129 aa, 14 kDa
Observed Molecular Weight: 15 kDa
GenBank Accession Number: BC002675
Gene Symbol: ISCA1
Gene ID (NCBI): 81689
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BUE6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924