Product Description
Size: 20ul / 150ul
The Adenosine A1 Receptor (20332-1-AP) by Proteintech is a Polyclonal antibody targeting Adenosine A1 Receptor in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples
20332-1-AP targets Adenosine A1 Receptor in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: PC-12 cells, PC-12
Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive FC (Intra) detected in: SH-SY5Y cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Background Information
ADORA1, also named as RDC7, is a receptor for adenosine. It is mediated by G proteins which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14092 Product name: Recombinant human ADORA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-243 aa of BC026340 Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF Predict reactive species
Full Name: adenosine A1 receptor
Calculated Molecular Weight: 326 aa, 37 kDa
Observed Molecular Weight: 40 and 45 kDa
GenBank Accession Number: BC026340
Gene Symbol: Adenosine A1 Receptor
Gene ID (NCBI): 134
RRID: AB_2878673
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P30542
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924