Iright
BRAND / VENDOR: Proteintech

Proteintech, 20336-1-AP, BTG3 Polyclonal antibody

CATALOG NUMBER: 20336-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BTG3 (20336-1-AP) by Proteintech is a Polyclonal antibody targeting BTG3 in WB, ELISA applications with reactivity to human samples 20336-1-AP targets BTG3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information BTG3 (B-cell translocation gene 3) is a member of the antiproliferative BTG/Tob gene family, which also includes BTG1, BTG2, BTG4, TOB, and TOB2. This gene family is characterized by similar N-terminal domains but divergent C-termini. BTG3 is considered a candidate tumor suppressor gene and plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. (PMID: 38714880) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14112 Product name: Recombinant human BTG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-296 aa of BC011957 Sequence: DPCEVCCRRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIMYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH Predict reactive species Full Name: BTG family, member 3 Calculated Molecular Weight: 296 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC011957 Gene Symbol: BTG3 Gene ID (NCBI): 10950 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14201 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924