Proteintech, 20341-1-AP, APJ/APLNR Polyclonal antibody

Size: 20ul / 150ul The APJ/APLNR (20341-1-AP) by Proteintech is a Polyclonal antibody targeting APJ/APLNR in WB, ELISA applications with reactivity to human, mouse samples 20341-1-AP targets APJ/APLNR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information APJ, also named APLNR and AGTRL1, belongs to the G-protein coupled receptor 1 family. It is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity. APJ is an alternative coreceptor with CD4 for HIV-1 infection. It may be involved in the development of AIDS dementia. APJ is expressed abundantly in the corpus callosum and spinal cord. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14138 Product name: Recombinant human APLNR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-380 aa of BC032688 Sequence: NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD Predict reactive species Full Name: apelin receptor Calculated Molecular Weight: 380 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC032688 Gene Symbol: APJ Gene ID (NCBI): 187 RRID: AB_2878676 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35414 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.