Iright
BRAND / VENDOR: Proteintech

Proteintech, 20348-1-AP, SMEK2 Polyclonal antibody

CATALOG NUMBER: 20348-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMEK2 (20348-1-AP) by Proteintech is a Polyclonal antibody targeting SMEK2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20348-1-AP targets SMEK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A2780 cells, HeLa cells, MCF-7 cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14156 Product name: Recombinant human SMEK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 589-738 aa of BC060855 Sequence: GLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVG Predict reactive species Full Name: SMEK homolog 2, suppressor of mek1 (Dictyostelium) Calculated Molecular Weight: 849 aa, 97 kDa Observed Molecular Weight: 94-97 kDa, 87 kDa GenBank Accession Number: BC060855 Gene Symbol: SMEK2 Gene ID (NCBI): 57223 RRID: AB_10694150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5MIZ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924