Proteintech, 20357-1-AP, Secretogranin II Polyclonal antibody

Size: 20ul / 150ul The Secretogranin II (20357-1-AP) by Proteintech is a Polyclonal antibody targeting Secretogranin II in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 20357-1-AP targets Secretogranin II in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IHC detected in: mouse pancreas tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SCG2, also known as secretogranin II or Chromogranin C, is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is widely distributed in nervous and endocrine tissues, and abundant in neuroendocrine granules. In the brain secretogranin II is almost completely processed to secretoneurin, a peptide involved in neurite outgrowth, neuroprotection and neuronal plasticity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14215 Product name: Recombinant human SCG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-617 aa of BC022509 Sequence: TPGGAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEGDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM Predict reactive species Full Name: secretogranin II (chromogranin C) Calculated Molecular Weight: 617 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC022509 Gene Symbol: Chromogranin C/SGII Gene ID (NCBI): 7857 RRID: AB_10699881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13521 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.