Proteintech, 20380-1-AP, AQP9 Polyclonal antibody

Size: 20ul / 150ul The AQP9 (20380-1-AP) by Proteintech is a Polyclonal antibody targeting AQP9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 20380-1-AP targets AQP9 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, mouse brain tissue, rat brain tissue, mouse liver tissue, mouse lung tissue, mouse testis tissue, rat liver tissue, rat testis tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue, mouse brain tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Aquaporins (AQPs), also known as water channel proteins, are members of a large protein family that osmotically modulate water fluid homeostasis in several tissues. AQP9 (Aquaporin 9) is a member of the aquaporin family that acts as a water-selective membrane channel, and it may be involved in cell migration, angiogenesis, and tumor growth. AQP9 is involved in arsenic uptake in hepatocellular carcinoma cells, in which p38-MAPK may play a limited role. AQP9 was demonstrated to promote astrocytoma cell invasion and motility via the AKT pathway. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14200 Product name: Recombinant human AQP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-295 aa of BC026258 Sequence: SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKAEQSEDKPEKYELSVIM Predict reactive species Full Name: aquaporin 9 Calculated Molecular Weight: 295 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC026258 Gene Symbol: AQP9 Gene ID (NCBI): 366 RRID: AB_2935448 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43315 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.