Iright
BRAND / VENDOR: Proteintech

Proteintech, 20388-1-AP, TMEM70 Polyclonal antibody

CATALOG NUMBER: 20388-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM70 (20388-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM70 in WB, IHC, ELISA applications with reactivity to human, mouse samples 20388-1-AP targets TMEM70 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A2780 cells, Jurkat cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication(PMID:21147908) identifies that TMEM70 gene defect as a pan-ethnic disorder and further redefines it as the most common cause of nuclear-origin ATP synthase deficiency. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14226 Product name: Recombinant human TMEM70 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-260 aa of BC002748 Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK Predict reactive species Full Name: transmembrane protein 70 Calculated Molecular Weight: 260 aa, 29 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC002748 Gene Symbol: TMEM70 Gene ID (NCBI): 54968 RRID: AB_10694436 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924