Iright
BRAND / VENDOR: Proteintech

Proteintech, 20389-1-AP, PLEKHF1 Polyclonal antibody

CATALOG NUMBER: 20389-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLEKHF1 (20389-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 20389-1-AP targets PLEKHF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human kidney tissue, human skeletal muscle tissue, mouse lung tissue, mouse spleen tissue, mouse thymus tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PLEKHF1, also named as APPD, LAPF, and ZFYVE15, is a 279 amino acid protein, which contains one PH domain and one FYVE-type zinc finger. PLEKHF1 translocates to lysosome during apoptosis, localizing in the nucleus and cytoplsam. PLEKHF1 is highly expressed in heart and skeletal muscle and weakly expressed in brain, thymus, spleen, kidney, liver, small intestine, placenta and lung. PLEKHF1 may induce apoptosis through the lysosomal-mitochondrial pathway. PLEKHF1 modulates the protein content of the plasma membrane and was involved in different endocytosis events. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14228 Product name: Recombinant human PLEKHF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-279 aa of BC002744 Sequence: FVVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS Predict reactive species Full Name: pleckstrin homology domain containing, family F (with FYVE domain) member 1 Calculated Molecular Weight: 279 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC002744 Gene Symbol: PLEKHF1 Gene ID (NCBI): 79156 RRID: AB_10666430 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S99 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924