Product Description
Size: 20ul / 150ul
The CCDC72 (20393-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC72 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples
20393-1-AP targets CCDC72 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: A549 cells, HEK-293 cells, MCF-7 cells
Positive IP detected in: A549 cells
Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
Background Information
CCDC72, also named as TMA7, is a novel modulator for hair follicle development. CCDC72 has the promoter activity and regulation of gene expression.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag13792 Product name: Recombinant human CCDC72 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC001102 Sequence: MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK Predict reactive species
Full Name: coiled-coil domain containing 72
Calculated Molecular Weight: 64 kDa, 7 kDa
Observed Molecular Weight: 7 kDa
GenBank Accession Number: BC001102
Gene Symbol: CCDC72
Gene ID (NCBI): 51372
RRID: AB_10667404
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y2S6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924