Proteintech, 20403-1-AP, GLUT3 Polyclonal antibody

Size: 20ul / 150ul The GLUT3 (20403-1-AP) by Proteintech is a Polyclonal antibody targeting GLUT3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20403-1-AP targets GLUT3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, U-251 cells, Jurkat cells, HeLa cells, C6 cells, mouse brain tissue, rat brain tissue, HepG2 cells Positive IHC detected in: mouse testis tissue, human lung cancer tissue, human breast cancer tissue, human placenta tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Glucose transporter 3 (GLUT3), also known as solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3), is a transporter protein regulating glucose transport across cell membranes and is a primary glucose transporter in neurons.What is the molecular weight of GLUT3? Is GLUT3 post-translationally modified?The molecular weight of GLUT3 transporter is 49-52 kDa and depends on the glycosylation pattern, which is tissue-specific (PMID: 9253355 and 9889355). GLUT3 can be N-glycosylated.What is the subcellular localization of GLUT3?Glucose transporters, including GLUT3, are multiple-pass integral membrane proteins. GLUT3 is present at the plasma membrane but is also a subject of recycling between the plasma membrane and endosomes.What molecules can be transported by GLUT3?Although the main substrate of GLUT3 transport is glucose, it can also transport mannose, galactose, and xylose.What is the tissue expression pattern of GLUT3?GLUT1 and GLUT3 are important for the transport of glucose into the central nervous system. While GLUT1 transports glucose through blood vessels and into astrocytes, GLUT3 is predominantly expressed in neurons, being their main glucose transporter (PMID: 9302083), and in testis (PMID: 18577699). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14203 Product name: Recombinant human SLC2A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-281 aa of BC039196 Sequence: ESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQ Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 3 Calculated Molecular Weight: 496 aa, 54 kDa Observed Molecular Weight: 54-60 kDa GenBank Accession Number: BC039196 Gene Symbol: GLUT3 Gene ID (NCBI): 6515 RRID: AB_10694437 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11169 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.