Proteintech, 20404-1-AP, SSTR2 Polyclonal antibody

Size: 20ul / 150ul The SSTR2 (20404-1-AP) by Proteintech is a Polyclonal antibody targeting SSTR2 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 20404-1-AP targets SSTR2 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse pancreas tissue, human pancreas tissue, human kidney tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Neuro-2a cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Somatostatin receptor 2 (SSTR2) is a G-protein coupled membrane receptor expressed in a variety of neural and neurosecretory tissue types. In neuroendocrine tumors (NETs), in which Somatostatin receptors (SSTRs) are commonly expressed, the detection of SSTR2 expression has both diagnostic and therapeutic potential. Besides NETs, SSTR2 immunostaining can be detected in other types of tumor cells(PMID:34786053). Moreover, SSTR2 is consistently expressed in Olfactory neuroblastoma (ONB) suggesting a role for somatostatin-analog based imaging and therapy in this disease. More generally, SSTR2 may be another marker of neuroendocrine diferentiation in ONB(PMID:33929681). SSTR2 has 2 isoforms with the MW of 40-41 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14205 Product name: Recombinant human SSTR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC019610 Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG Predict reactive species Full Name: somatostatin receptor 2 Calculated Molecular Weight: 369 aa, 41 kDa GenBank Accession Number: BC019610 Gene Symbol: SSTR2 Gene ID (NCBI): 6752 RRID: AB_2878683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30874 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.