Product Description
Size: 20ul / 150ul
The ACN9 (20410-1-AP) by Proteintech is a Polyclonal antibody targeting ACN9 in WB, ELISA applications with reactivity to human samples
20410-1-AP targets ACN9 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14242 Product name: Recombinant human ACN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-125 aa of BC022858 Sequence: KSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF Predict reactive species
Full Name: ACN9 homolog (S. cerevisiae)
Calculated Molecular Weight: 125 aa, 15 kDa
Observed Molecular Weight: 15 kDa
GenBank Accession Number: BC022858
Gene Symbol: ACN9
Gene ID (NCBI): 57001
RRID: AB_3085604
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NRP4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924