Proteintech, 20410-1-AP, ACN9 Polyclonal antibody

Size: 20ul / 150ul The ACN9 (20410-1-AP) by Proteintech is a Polyclonal antibody targeting ACN9 in WB, ELISA applications with reactivity to human samples 20410-1-AP targets ACN9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14242 Product name: Recombinant human ACN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-125 aa of BC022858 Sequence: KSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF Predict reactive species Full Name: ACN9 homolog (S. cerevisiae) Calculated Molecular Weight: 125 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC022858 Gene Symbol: ACN9 Gene ID (NCBI): 57001 RRID: AB_3085604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.