Iright
BRAND / VENDOR: Proteintech

Proteintech, 20415-1-AP, MIF Polyclonal antibody

CATALOG NUMBER: 20415-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MIF (20415-1-AP) by Proteintech is a Polyclonal antibody targeting MIF in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 20415-1-AP targets MIF in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HL-60 cells, U-937 cells, Y79 cells, U-87 MG cells, HEK-293T cells, HUVEC cells, J774A.1 cells, Neuro-2a cells, mouse spleen tissue, rat spleen tissue, Jurkat cells Positive IP detected in: mouse spleen tissue Positive IF/ICC detected in: U-251 cells Positive FC (Intra) detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14058 Product name: Recombinant human MIF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-115 aa of BC000447 Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Predict reactive species Full Name: macrophage migration inhibitory factor (glycosylation-inhibiting factor) Calculated Molecular Weight: 115 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC000447 Gene Symbol: MIF Gene ID (NCBI): 4282 RRID: AB_10694820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14174 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924