Iright
BRAND / VENDOR: Proteintech

Proteintech, 20416-1-AP, SPP Polyclonal antibody

CATALOG NUMBER: 20416-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPP (20416-1-AP) by Proteintech is a Polyclonal antibody targeting SPP in WB, IHC, ELISA applications with reactivity to human, mouse samples 20416-1-AP targets SPP in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse liver tissue, mouse kidney tissue, U2OS cells Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14158 Product name: Recombinant human SPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-220 aa of BC008938 Sequence: VLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDV Predict reactive species Full Name: histocompatibility (minor) 13 Calculated Molecular Weight: 377 aa, 41 kDa Observed Molecular Weight: 45 kDa, 100 kDa GenBank Accession Number: BC008938 Gene Symbol: HM13/SPP Gene ID (NCBI): 81502 RRID: AB_10665421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924