Iright
BRAND / VENDOR: Proteintech

Proteintech, 20417-1-AP, PCNXL2 Polyclonal antibody

CATALOG NUMBER: 20417-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCNXL2 (20417-1-AP) by Proteintech is a Polyclonal antibody targeting PCNXL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 20417-1-AP targets PCNXL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PCNXL2, also named as KIAA0435, belongs to the pecanex family. It may play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H). PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors. PCNXL2 is a glycosylation protein. The MW migrates to 260kd. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14161 Product name: Recombinant human PCNXL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1108-1201 aa of BC008300 Sequence: LSFAVSASTVFLSLRPFLSIVLFALAGAVGFVTHYVLPQLRKHHPWMWISHPILKNKEYHQREVRDVAHLMWFERLYVWLQCFEKYILYPALIL Predict reactive species Full Name: pecanex-like 2 (Drosophila) Calculated Molecular Weight: 2137 aa, 237 kDa Observed Molecular Weight: 237-260 kDa GenBank Accession Number: BC008300 Gene Symbol: PCNXL2 Gene ID (NCBI): 80003 RRID: AB_10792807 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NKB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924