Proteintech, 20439-1-AP, CLK1 Polyclonal antibody

Size: 20ul / 150ul The CLK1 (20439-1-AP) by Proteintech is a Polyclonal antibody targeting CLK1 in WB, IP, ELISA applications with reactivity to human samples 20439-1-AP targets CLK1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, COLO 320 cells, HeLa cells, Jurkat cells, LNCaP cells Positive IP detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information CLK1 (CDC-like kinase 1) is the dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. It phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. It can phosphorylate: SRSF1, SRSF3 and PTPN1 (PMID: 10480872; 19168442). It also regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells (PMID: 19168442). Elevated CLK1 activity is frequently detected in cancers, where it alters splice isoform balance to promote proliferation, invasion and chemoresistance, making it an emerging therapeutic target. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14214 Product name: Recombinant human CLK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC031549 Sequence: MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVED Predict reactive species Full Name: CDC-like kinase 1 Calculated Molecular Weight: 484 aa, 57 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC031549 Gene Symbol: CLK1 Gene ID (NCBI): 1195 RRID: AB_2878686 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49759 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.