Iright
BRAND / VENDOR: Proteintech

Proteintech, 20467-1-AP, Spexin Polyclonal antibody

CATALOG NUMBER: 20467-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Spexin (20467-1-AP) by Proteintech is a Polyclonal antibody targeting Spexin in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 20467-1-AP targets Spexin in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human kidney tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue, mouse liver tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Spexin (SPX), also known as neuropeptide Q, is a novel and highly conserved neuroendocrine peptide discovered through bioinformatics. Spexin and its receptors (primarily galanin receptor types 2 and 3) are widely expressed throughout the body, including the central nervous system, gastrointestinal tract, adipose tissue, kidneys, and cardiovascular system. Research indicates that Spexin is a multifunctional regulatory peptide, with its most central role being in energy homeostasis and metabolic regulation. It functions to suppress appetite, reduce body weight, and improve insulin resistance and glucose metabolism, making it a potential biomarker and therapeutic target for metabolic diseases such as obesity and type 2 diabetes. Additionally, Spexin is involved in regulating various physiological and pathological processes, including pain perception, anxiety- and depression-like behaviors, cardiovascular function, and reproductive activities. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14304 Product name: Recombinant human C12orf39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC004336 Sequence: MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW Predict reactive species Full Name: chromosome 12 open reading frame 39 Calculated Molecular Weight: 116 aa, 13 kDa GenBank Accession Number: BC004336 Gene Symbol: C12orf39 Gene ID (NCBI): 80763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BT56 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924