Iright
BRAND / VENDOR: Proteintech

Proteintech, 20489-1-AP, DAXX Polyclonal antibody

CATALOG NUMBER: 20489-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DAXX (20489-1-AP) by Proteintech is a Polyclonal antibody targeting DAXX in WB, IHC, ELISA applications with reactivity to human, mouse samples 20489-1-AP targets DAXX in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Y79 cells, HeLa cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Death associated protein 6 (DAXX) is a ubiquitous protein implicated in various cellular processes such as apoptosis, tumorigenesis, development and transcription. It has been shown to translocate from the nucleus to the cytoplasm under conditions of stress and to activate the Jun N-terminal kinase (JNK) pathway. Somatic mutations of death associated protein (DAXX) have been found in ALT cancers, including pancreatic neuroendocrine (panNET) cancers and glioblastoma multiforme (GBM) cancers. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14519 Product name: Recombinant human DAXX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC109074 Sequence: MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVD Predict reactive species Full Name: death-domain associated protein Calculated Molecular Weight: 740 aa, 81 kDa Observed Molecular Weight: 120 kDa, 70 kDa GenBank Accession Number: BC109074 Gene Symbol: DAXX Gene ID (NCBI): 1616 RRID: AB_10693620 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UER7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924