Iright
BRAND / VENDOR: Proteintech

Proteintech, 20492-1-AP, C19orf50 Polyclonal antibody

CATALOG NUMBER: 20492-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C19orf50 (20492-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf50 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 20492-1-AP targets C19orf50 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, Calu-3 cells, NCI-H1299 cells, human placenta tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C19orf50, also known as KXD1 (KxDL motif-containing protein 1), a human uncharacterized coiled-coil protein, is a BLOS1-interacting protein. C19orf50 has been shown recently to interact with BLOC-1 subunits and may play a role in lysosome movement and localization at the cell periphery. C19orf50 was evaluated in NSCLC and LUAD (PMID: 33936200, 22554196). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13743 Product name: Recombinant human C19orf50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC001080 Sequence: MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE Predict reactive species Full Name: chromosome 19 open reading frame 50 Calculated Molecular Weight: 176 aa, 20 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC001080 Gene Symbol: C19orf50 Gene ID (NCBI): 79036 RRID: AB_3669335 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQD3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924