Iright
BRAND / VENDOR: Proteintech

Proteintech, 20493-1-AP, NME2 Polyclonal antibody

CATALOG NUMBER: 20493-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NME2 (20493-1-AP) by Proteintech is a Polyclonal antibody targeting NME2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20493-1-AP targets NME2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, Jurkat cells, mouse liver tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B) and NM23B, and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates, supplying nucleotide pools for DNA/RNA synthesis, and interacts with membrane receptors and constitutes a novel molecular regulatory mechanism of GPCR endocytosis. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13913 Product name: Recombinant human NME2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC002476 Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Predict reactive species Full Name: non-metastatic cells 2, protein (NM23B) expressed in Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC002476 Gene Symbol: NME2 Gene ID (NCBI): 4831 RRID: AB_10695634 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22392 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924