Proteintech, 20494-1-AP, ABHD6 Polyclonal antibody

Size: 20ul / 150ul The ABHD6 (20494-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20494-1-AP targets ABHD6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat spleen tissue Positive IHC detected in: mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C6 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information α/β-hydrolase domain 6 (ABHD6) is a lipase linked to physiological functions affecting energy metabolism. ABHD6, which was first identified in the brain ( PMID: 18096503) , is a ubiquitously expressed lipase. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13968 Product name: Recombinant human ABHD6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-337 aa of BC001698 Sequence: LWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Predict reactive species Full Name: abhydrolase domain containing 6 Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC001698 Gene Symbol: ABHD6 Gene ID (NCBI): 57406 RRID: AB_2878694 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BV23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.