Iright
BRAND / VENDOR: Proteintech

Proteintech, 20495-1-AP, ATRX Polyclonal antibody

CATALOG NUMBER: 20495-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATRX (20495-1-AP) by Proteintech is a Polyclonal antibody targeting ATRX in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20495-1-AP targets ATRX in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information The α-thalassemia mental retardation X-linked protein (ATRX) is a member of the Switch 2, sucrose non-fermenting 2 (SWI2/SNF2) family of helicases/ATPases that exhibits chromatin remodeling activity. ATRX contains an atypical plant homeodomain (PHD) finger domain that recognizes a combinatorial modification pattern on histone H3 tails. ATRX mutations in cancer are most commonly found in pediatric and adolescent malignancies including glioma, neuroblastoma, adrenocortical carcinoma and osteosarcoma(PMID: 32015155). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13984 Product name: Recombinant human ATRX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-87 aa of BC002521 Sequence: MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVN Predict reactive species Full Name: alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) Calculated Molecular Weight: 2492 aa, 283 kDa Observed Molecular Weight: 280-300 kDa GenBank Accession Number: BC002521 Gene Symbol: ATRX Gene ID (NCBI): 546 RRID: AB_3085606 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46100 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924