Proteintech, 20496-1-AP, CEPT1 Polyclonal antibody

Size: 20ul / 150ul The CEPT1 (20496-1-AP) by Proteintech is a Polyclonal antibody targeting CEPT1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20496-1-AP targets CEPT1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse liver tissue, human cervical cancer tissue, human pancreas tissue, human tonsillitis tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Choline-enthanolamine phosphotransferase 1 (CEPT1) is a 47-kDa membrane-bound protein that catalyzes the terminal step of the Kennedy pathway. CEPT1 is encoded by the Cept1 gene and is responsible for phosphatidylcholine (PC) and phosphatidylethanolamine (PE) production (PMID: 33214136, 30030520). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14140 Product name: Recombinant human CEPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032610 Sequence: MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITII Predict reactive species Full Name: choline/ethanolamine phosphotransferase 1 Calculated Molecular Weight: 416 aa, 47 kDa GenBank Accession Number: BC032610 Gene Symbol: CEPT1 Gene ID (NCBI): 10390 RRID: AB_10694283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6K0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.