Iright
BRAND / VENDOR: Proteintech

Proteintech, 20502-1-AP, STARD3NL Polyclonal antibody

CATALOG NUMBER: 20502-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STARD3NL (20502-1-AP) by Proteintech is a Polyclonal antibody targeting STARD3NL in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20502-1-AP targets STARD3NL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells, HEK-293 cells, mouse kidney tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14273 Product name: Recombinant human STARD3NL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-234 aa of BC005959 Sequence: ILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL Predict reactive species Full Name: STARD3 N-terminal like Calculated Molecular Weight: 234 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC005959 Gene Symbol: STARD3NL Gene ID (NCBI): 83930 RRID: AB_10694281 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95772 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924