Proteintech, 20523-1-AP, DDX49 Polyclonal antibody

Size: 20ul / 150ul The DDX49 (20523-1-AP) by Proteintech is a Polyclonal antibody targeting DDX49 in WB, ELISA applications with reactivity to human, mouse, rat samples 20523-1-AP targets DDX49 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14373 Product name: Recombinant human DDX49 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 134-313 aa of BC002674 Sequence: HLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLD Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 Calculated Molecular Weight: 483 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC002674 Gene Symbol: DDX49 Gene ID (NCBI): 54555 RRID: AB_2878698 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6V7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.