Proteintech, 20531-1-AP, RUNDC3A Polyclonal antibody

Size: 20ul / 150ul The RUNDC3A (20531-1-AP) by Proteintech is a Polyclonal antibody targeting RUNDC3A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20531-1-AP targets RUNDC3A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-12 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14393 Product name: Recombinant human RUNDC3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-405 aa of BC006194 Sequence: VRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN Predict reactive species Full Name: RUN domain containing 3A Calculated Molecular Weight: 446 aa, 50 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC006194 Gene Symbol: RUNDC3A Gene ID (NCBI): 10900 RRID: AB_10695757 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q59EK9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.