Proteintech, 20542-1-AP, NUDT3/4/10/11 Polyclonal antibody

Size: 20ul / 150ul The NUDT3/4/10/11 (20542-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT3/4/10/11 in WB, ELISA applications with reactivity to human, mouse, rat samples 20542-1-AP targets NUDT3/4/10/11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information NUDT3 (nucleoside diphosphate linked moiety X-type motif 3), also named as DIPP1, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3/4/10/11). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14587 Product name: Recombinant human NUDT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC007727 Sequence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 3 Calculated Molecular Weight: 172 aa, 19 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: BC007727 Gene Symbol: NUDT3 Gene ID (NCBI): 11165 RRID: AB_10696178 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95989 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.