Proteintech, 20587-1-AP, SSTR1 Polyclonal antibody

Size: 20ul / 150ul The SSTR1 (20587-1-AP) by Proteintech is a Polyclonal antibody targeting SSTR1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 20587-1-AP targets SSTR1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, BxPC-3 cells, mouse brain tissue, mouse small intestine tissue, SH-SY5Y cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14287 Product name: Recombinant human SSTR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC035618 Sequence: MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL Predict reactive species Full Name: somatostatin receptor 1 Calculated Molecular Weight: 391 aa, 43 kDa Observed Molecular Weight: 53 kDa, 63 kDa GenBank Accession Number: BC035618 Gene Symbol: SSTR1 Gene ID (NCBI): 6751 RRID: AB_10755146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30872 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.