Proteintech, 20602-1-AP, C16orf70 Polyclonal antibody

Size: 20ul / 150ul The C16orf70 (20602-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf70 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20602-1-AP targets C16orf70 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The function of C20orf30 has not been widely studied, and is yet to be fully elucidated. The MW of this protein is 48 kDa, and our antibody specially recognises the 48 kDa protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14576 Product name: Recombinant human C16orf70 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-422 aa of BC004556 Sequence: NQRLKVIEVCDLTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVYNSAEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDANTHKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENADGQTETCTTYSKWDNIQELLGHPVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYGPPRPGSHLRTAELP Predict reactive species Full Name: chromosome 16 open reading frame 70 Calculated Molecular Weight: 422 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC004556 Gene Symbol: C16orf70 Gene ID (NCBI): 80262 RRID: AB_10694825 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSU1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.