Iright
BRAND / VENDOR: Proteintech

Proteintech, 20613-1-AP, PORCN Polyclonal antibody

CATALOG NUMBER: 20613-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PORCN (20613-1-AP) by Proteintech is a Polyclonal antibody targeting PORCN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20613-1-AP targets PORCN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: mouse brain tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PORCN is one of several related membrane-bound O-acyltransferase (MBOAT) enzymes encoding a 461 amino acid-sized (52 kDa) protein named porcupine located in the endoplasmic reticulum and known to be involved in the processing, secretion, and signaling of Wnt proteins (PMID: 17546031). Overexpression of PORCN could promote the proliferation and migration abilities of HCC cells both in vitro and in vivo (PMID: 37588740, 23188502). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14664 Product name: Recombinant human PORCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 258-348 aa of BC019080 Sequence: EATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLS Predict reactive species Full Name: porcupine homolog (Drosophila) Calculated Molecular Weight: 461 aa, 52 kDa Observed Molecular Weight: 43~50 kDa GenBank Accession Number: BC019080 Gene Symbol: PORCN Gene ID (NCBI): 64840 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H237 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924