Iright
BRAND / VENDOR: Proteintech

Proteintech, 20616-1-AP, C2orf7 Polyclonal antibody

CATALOG NUMBER: 20616-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C2orf7 (20616-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf7 in WB, ELISA applications with reactivity to human samples 20616-1-AP targets C2orf7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human serum Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Protease-associated domain-containing 1 (PRADC1), also known as C2orf7, is an enigmatic secretory protein widely expressed in humans and mice. C2orf7 is a ∼30-kDa N-glycosylated secretory protein with a protease-associated domain (PMID: 31689374). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14678 Product name: Recombinant human C2orf7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC005069 Sequence: MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW Predict reactive species Full Name: chromosome 2 open reading frame 7 Calculated Molecular Weight: 188 aa, 21 kDa Observed Molecular Weight: 21-30 kDa GenBank Accession Number: BC005069 Gene Symbol: C2orf7 Gene ID (NCBI): 84279 RRID: AB_3085609 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSG0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924