Proteintech, 20619-1-AP, THSD4 Polyclonal antibody

Size: 20ul / 150ul The THSD4 (20619-1-AP) by Proteintech is a Polyclonal antibody targeting THSD4 in IHC, ELISA applications with reactivity to human samples 20619-1-AP targets THSD4 in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14682 Product name: Recombinant human THSD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 669-1018 aa of BC008840 Sequence: SAQTFPVRHPDRFSPHRPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDSSMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPAEATPCDNGPCTGKVEWFAGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEKPPSQQSCHLKPCGAKWFSTEWSMSLQRAMLTRPS Predict reactive species Full Name: thrombospondin, type I, domain containing 4 Calculated Molecular Weight: 490 aa, 55 kDa GenBank Accession Number: BC008840 Gene Symbol: THSD4 Gene ID (NCBI): 79875 RRID: AB_2878709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q6ZMP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.