Proteintech, 20760-1-AP, FAM57B Polyclonal antibody

Size: 20ul / 150ul The FAM57B (20760-1-AP) by Proteintech is a Polyclonal antibody targeting FAM57B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20760-1-AP targets FAM57B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse colon tissue, HeLa cells, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14707 Product name: Recombinant human FAM57B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-140 aa of BC007892 Sequence: SVQAIMASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV Predict reactive species Full Name: family with sequence similarity 57, member B Calculated Molecular Weight: 274 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC007892 Gene Symbol: FAM57B Gene ID (NCBI): 83723 RRID: AB_10732598 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q71RH2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.