Proteintech, 20768-1-AP, TMEM41A Polyclonal antibody

Size: 20ul / 150ul The TMEM41A (20768-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM41A in WB, ELISA applications with reactivity to human, mouse, rat samples 20768-1-AP targets TMEM41A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse small intestine tissue, rat liver tissue, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14753 Product name: Recombinant human TMEM41A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC008043 Sequence: MRPLLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAYLYK Predict reactive species Full Name: transmembrane protein 41A Calculated Molecular Weight: 264 aa, 30 kDa Observed Molecular Weight: 26-28 kDa GenBank Accession Number: BC008043 Gene Symbol: TMEM41A Gene ID (NCBI): 90407 RRID: AB_10693679 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96HV5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.