Iright
BRAND / VENDOR: Proteintech

Proteintech, 20776-1-AP, FAM96A Polyclonal antibody

CATALOG NUMBER: 20776-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM96A (20776-1-AP) by Proteintech is a Polyclonal antibody targeting FAM96A in IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 20776-1-AP targets FAM96A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: U-937 cells, THP-1 cells Positive IHC detected in: mouse colon tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, U-251 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FAM96A (family with sequence similarity 96, member A), also called cytosolic iron-sulfur assembly component 2A (CIAO2A), a recently identified member of the cytosolic iron-sulfur (Fe/S) protein assembly machinery and regulator of cellular iron homeostasis, is a novel pro-apoptotic APAF1-binding protein facilitating the effective induction of cell death via the mitochondrial apoptosis pathway. FAM96A is substantially enriched in macrophages comprised primarily of a DUF59 domain (residues 31-157) and an N-terminal signal peptide (residues 1-27), that is expressed at low levels in tumor cells (PMID: 29399066). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14770 Product name: Recombinant human FAM96A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC008865 Sequence: MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHC Predict reactive species Full Name: family with sequence similarity 96, member A Calculated Molecular Weight: 160 aa, 18 kDa Observed Molecular Weight: 18-21 kDa GenBank Accession Number: BC008865 Gene Symbol: FAM96A Gene ID (NCBI): 84191 RRID: AB_3669346 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5X1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924