Iright
BRAND / VENDOR: Proteintech

Proteintech, 20786-1-AP, WDR55 Polyclonal antibody

CATALOG NUMBER: 20786-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR55 (20786-1-AP) by Proteintech is a Polyclonal antibody targeting WDR55 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 20786-1-AP targets WDR55 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information WD repeat domain 55 (WDR55) also named as, FLJ20195, is a 383 amino acid protein, which contains seven WD repeats and belongs to the WD repeat WDR55 family. WDR55 localizes in the nucleus and cytoplasm. WDR55 acts as a modulator of rRNA synthesis and play a central role in organogenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14241 Product name: Recombinant human WDR55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-383 aa of BC002482 Sequence: MDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDDYRRRKKKGGPLRALSSKTWSTDDFFAGLREEGEDSMAQEEKEETGDDSD Predict reactive species Full Name: WD repeat domain 55 Calculated Molecular Weight: 383 aa, 42 kDa Observed Molecular Weight: 42-50 kDa GenBank Accession Number: BC002482 Gene Symbol: WDR55 Gene ID (NCBI): 54853 RRID: AB_2878739 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6Y2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924