Iright
BRAND / VENDOR: Proteintech

Proteintech, 20787-1-AP, SMO Polyclonal antibody

CATALOG NUMBER: 20787-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMO (20787-1-AP) by Proteintech is a Polyclonal antibody targeting SMO in IHC, ELISA applications with reactivity to human, mouse, rat samples 20787-1-AP targets SMO in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human prostate cancer tissue, human testis tissue, human colon cancer tissue, mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Smoothened (SMO) is a G protein-coupled receptor that is a component of the hedgehog (Hh) signaling pathway and is conserved from flies to humans. The Hh pathway plays a central role in animal development and stem-cell function. Defects in Hh signaling lead to birth defects and cancer in humans. Expressed on the primary cilium, SMO interacts with the patched protein, a receptor for Hh proteins. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14322 Product name: Recombinant human SMO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-787 aa of BC009989 Sequence: RRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF Predict reactive species Full Name: smoothened homolog (Drosophila) Calculated Molecular Weight: 787 aa, 86 kDa GenBank Accession Number: BC009989 Gene Symbol: SMO Gene ID (NCBI): 6608 RRID: AB_2878740 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99835 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924