Iright
BRAND / VENDOR: Proteintech

Proteintech, 20793-1-AP, EVA1B Polyclonal antibody

CATALOG NUMBER: 20793-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EVA1B (20793-1-AP) by Proteintech is a Polyclonal antibody targeting EVA1B in WB, ELISA applications with reactivity to human samples 20793-1-AP targets EVA1B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information EVA1B, also known as FAM176B or C1orf78, is a single-pass membrane protein that belongs to the FAM176 family. EVA1B is an important paralog of the EVA1A and is associated with the tumor immune microenvironment and clinical prognosis Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14578 Product name: Recombinant human FAM176B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC006241 Sequence: MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVF Predict reactive species Full Name: family with sequence similarity 176, member B Calculated Molecular Weight: 165 aa, 18 kDa Observed Molecular Weight: 25-26 kDa GenBank Accession Number: BC006241 Gene Symbol: FAM176B Gene ID (NCBI): 55194 RRID: AB_3669348 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVM1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924